PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G22630.1
Common NameAGL17, T9I22.7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MIKC_MADS
Protein Properties Length: 227aa    MW: 26313.9 Da    PI: 9.3102
Description AGAMOUS-like 17
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G22630.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.71.2e-261059251
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 +i++++ rqvtfskRr+g++KKA+EL +LCdaev++iifs+t+kly+++s
  AT2G22630.1 10 KIDDSTSRQVTFSKRRKGLIKKAKELAILCDAEVCLIIFSNTDKLYDFAS 59
                 79**********************************************86 PP

2K-box74.72.6e-2581171999
        K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                  + +++ + +q+e++ L++e+++Lq++ R+l G +L+ Ls+keLq++e+qLe sl+ iR k++++l+++i+el +k + +++en +L++k++
  AT2G22630.1  81 NPASEVKFWQREAETLRQELHSLQENYRQLTGVELNGLSVKELQNIESQLEMSLRGIRMKREQILTNEIKELTRKRNLVHHENLELSRKVQ 171
                  567889***********************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.969161IPR002100Transcription factor, MADS-box
SMARTSM004321.6E-37160IPR002100Transcription factor, MADS-box
CDDcd002657.24E-37273No hitNo description
SuperFamilySSF554551.03E-30291IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-25323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.4E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-253859IPR002100Transcription factor, MADS-box
PfamPF014862.5E-2384170IPR002487Transcription factor, K-box
PROSITE profilePS5129714.49686176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006036anatomyroot epidermis
PO:0009005anatomyroot
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020123anatomyroot cap
PO:0025181anatomyroot elongation zone
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MGRGKIVIQK IDDSTSRQVT FSKRRKGLIK KAKELAILCD AEVCLIIFSN TDKLYDFASS  60
SVKSTIERFN TAKMEEQELM NPASEVKFWQ REAETLRQEL HSLQENYRQL TGVELNGLSV  120
KELQNIESQL EMSLRGIRMK REQILTNEIK ELTRKRNLVH HENLELSRKV QRIHQENVEL  180
YKKAYGTSNT NGLGHHELVD AVYESHAQVR LQLSQPEQSH YKTSSNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D9e-17269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C9e-17269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B9e-17269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A9e-17269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_S1e-16169169Myocyte-specific enhancer factor 2B
1tqe_R1e-16169169Myocyte-specific enhancer factor 2B
1tqe_Q1e-16169169Myocyte-specific enhancer factor 2B
1tqe_P1e-16169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible265351_at0.0
Expression AtlasAT2G22630-
AtGenExpressAT2G22630-
ATTED-IIAT2G22630-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Preferentially expressed in roots.
Functional Description ? help Back to Top
Source Description
TAIREncodes a MADs domain containing protein involved in promoting flowering. Loss of function mutations show delayed flowering in long days and reduced levels of LFY and AP1 expression.
UniProtProbable transcription factor.
Function -- GeneRIF ? help Back to Top
  1. The activitiy of the flowering promoter, AGAMOUS-LIKE 17, acting in the photoperiod pathway of A. thaliana independently of FT, is reported.
    [PMID: 18363787]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G22630.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT5G15840 (A)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G69120(A), AT5G61850(A)
Interaction ? help Back to Top
Source Intact With
BioGRIDAT2G45660, AT3G57230, AT4G37940, AT1G48150
IntActSearch Q38840
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G22630
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935580.0AB493558.1 Arabidopsis thaliana At2g22630 mRNA for hypothetical protein, partial cds, clone: RAAt2g22630.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_179848.11e-167agamous-like MADS-box protein AGL17
SwissprotQ388401e-169AGL17_ARATH; Agamous-like MADS-box protein AGL17
TrEMBLC0SV551e-167C0SV55_ARATH; Putative uncharacterized protein At2g22630 (Fragment)
STRINGAT2G22630.11e-167(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53024105
Representative plantOGRP1617761
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Burgeff C,Liljegren SJ,Tapia-L
    MADS-box gene expression in lateral primordia, meristems and differentiated tissues of Arabidopsis thaliana roots.
    Planta, 2002. 214(3): p. 365-72
    [PMID:11855641]
  3. Parenicová L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  4. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  5. Becker A,Theissen G
    The major clades of MADS-box genes and their role in the development and evolution of flowering plants.
    Mol. Phylogenet. Evol., 2003. 29(3): p. 464-89
    [PMID:14615187]
  6. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  7. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  8. Pina C,Pinto F,Feij
    Gene family analysis of the Arabidopsis pollen transcriptome reveals biological implications for cell growth, division control, and gene expression regulation.
    Plant Physiol., 2005. 138(2): p. 744-56
    [PMID:15908605]
  9. Gan Y,Filleur S,Rahman A,Gotensparre S,Forde BG
    Nutritional regulation of ANR1 and other root-expressed MADS-box genes in Arabidopsis thaliana.
    Planta, 2005. 222(4): p. 730-42
    [PMID:16021502]
  10. Han P,GarcĂ­a-Ponce B,Fonseca-Salazar G,Alvarez-Buylla ER,Yu H
    AGAMOUS-LIKE 17, a novel flowering promoter, acts in a FT-independent photoperiod pathway.
    Plant J., 2008. 55(2): p. 253-65
    [PMID:18363787]
  11. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  12. Rounsley SD,Ditta GS,Yanofsky MF
    Diverse roles for MADS box genes in Arabidopsis development.
    Plant Cell, 1995. 7(8): p. 1259-69
    [PMID:7549482]
  13. Zachgo S,Saedler H,Schwarz-Sommer Z
    Pollen-specific expression of DEFH125, a MADS-box transcription factor in Antirrhinum with unusual features.
    Plant J., 1997. 11(5): p. 1043-50
    [PMID:9193074]
  14. Heard J,Caspi M,Dunn K
    Evolutionary diversity of symbiotically induced nodule MADS box genes: characterization of nmhC5, a member of a novel subfamily.
    Mol. Plant Microbe Interact., 1997. 10(5): p. 665-76
    [PMID:9204570]
  15. Carmona MJ,Ortega N,Garcia-Maroto F
    Isolation and molecular characterization of a new vegetative MADS-box gene from Solanum tuberosum L.
    Planta, 1998. 207(2): p. 181-8
    [PMID:9951721]